PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G052200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 648aa    MW: 70999.4 Da    PI: 4.2718
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G052200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.62.5e-49141501128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkya.........tgkrknratks 80 
                         l+pGfrFhPtdeelv++yL+++v g++l++ ++i+evd+y++ePwdLp  +++++++++wyfF++ d+k a          g+r+nrat +
  Brast04G052200.2.p  14 LAPGFRFHPTDEELVSYYLRRRVLGRRLRI-DAIAEVDLYRLEPWDLPslSRIRSRDSQWYFFARLDRKVAgagaggrggPGNRTNRATPR 103
                         579***************************.99***************5448999999***********99877777665577******** PP

                 NAM  81 gyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         gyWk+tgkd+ev++ +g++vg+kktLvf+ grapkg +t+Wvmheyrl
  Brast04G052200.2.p 104 GYWKTTGKDREVFH-RGKAVGMKKTLVFHAGRAPKGDRTNWVMHEYRL 150
                         **************.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.42E-5611168IPR003441NAC domain
PROSITE profilePS5100555.80414168IPR003441NAC domain
PfamPF023655.5E-2716150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MSPSLPDHSP EVPLAPGFRF HPTDEELVSY YLRRRVLGRR LRIDAIAEVD LYRLEPWDLP  60
SLSRIRSRDS QWYFFARLDR KVAGAGAGGR GGPGNRTNRA TPRGYWKTTG KDREVFHRGK  120
AVGMKKTLVF HAGRAPKGDR TNWVMHEYRL LDNDGPQDLH VVCRIFQKVG TGPQNGAQYG  180
APYMEEEWEE EDDATENAPA NGASTEMAAT TDTASPESNV EDENMYSKTN ELVQTQEVLN  240
PPDTAPLLAQ GLETDEGSYG DGVISLEEIL QEPVSNVSVE NIGEPEEQTA IDDHFSLADL  300
SGYPSQDDGY VGHNGPIICR DPSNGDHAYW PLRTYGNQNH ANGTLNAEEF FDTGNDTNTY  360
SVQQQICPSN GQNLYLQTNG LPAPQQVDDN MAFYDASSTH KWVDGKDDFA NVNELLYQPE  420
NEPLFDVDDL MAYFDAAEDE LKFDMLGPVE GPNCQLPDNM LEFAPKNENM DGFTFDGISK  480
TSANVQYVAS SSGSHENLYP DTAVPDIPMD DNADKSFGKR FASVLGSIPA PPAMASEFPP  540
ATGKSVASLS AVNGPSSIHV TAGIVQLGGL TFSGSSEHWP LQKNGDFSLL LSFTVESDVS  600
TKSIGFDEPA TQLSTVPMVL RGGLYLFFVS AMILMLSYKV GSCIYSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-4471508140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570443.10.0PREDICTED: NAC domain-containing protein 78
TrEMBLI1IE750.0I1IE75_BRADI; Uncharacterized protein
STRINGBRADI3G56080.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.18e-77NAC domain containing protein 2